Skip to Content
Merck
All Photos(2)

Key Documents

WH0004240M9

Sigma-Aldrich

Monoclonal Anti-MFGE8 antibody produced in mouse

clone 3E9, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-BA46, Anti-EDIL1, Anti-HsT19888, Anti-OAcGD3S, Anti-milk fat globule-EGF factor 8 protein

Sign Into View Organizational & Contract Pricing

Select a Size

100 μG
€417.00

€417.00


Check Cart for Availability


Select a Size

Change View
100 μG
€417.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

€417.00


Check Cart for Availability

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3E9, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... MFGE8(4240)

General description

Milk fat globule epidermal growth factor 8 (Mfge8) is a peripheral membrane soluble glycoprotein. It is liberated by several cells like macrophages. This protein is also termed as a phagocytosis “eat me” signal. It is predominantly expressed in lactating mammary glands.MFG-E8 has two-repeated EGF-like domains, a mucin-like domain, two-repeated discoidin-like domains (C-domains) and an integrin-binding motif (RGD sequence) in the EGF-like domain. This gene is located on human chromosome 15q26.

Immunogen

MFGE8 (NP_005919, 61 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
YAGNHCETKCVEPLGMENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFD

Biochem/physiol Actions

Milk fat globule epidermal growth factor 8 (Mfge8) controls inflammation and immunity by mediating apoptotic cell clearance. It plays an important role in autoimmunity, neoangiogenesis and sperm-egg binding. Mfge8 also plays a major role in membrane vesicle secretion like budding or shedding of plasma membrane (microvesicles) and exocytosis of endocytic multivesicular bodies (exosomes).

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Mutation Identification for Epilepsy in the US Hispanic Population Using Whole-Ex- ome-Sequencing
Villanos M, et al.
HSOA Journal of Cell Biology and Cell Metabolism, 3(011) (2016)
Secretion of a peripheral membrane protein, MFG-E8, as a complex with membrane vesicles
Oshima K, et al.
European Journal of Biochemistry, 269(4), 1209-1218 (2002)
Mfge8 diminishes the severity of tissue fibrosis in mice by binding and targeting collagen for uptake by macrophages
Atabai K, et al.
The Journal of Clinical Investigation, 119(12), 3713-3722 (2009)
Fabiana N Soki et al.
The Journal of biological chemistry, 289(35), 24560-24572 (2014-07-10)
Tumor cells secrete factors that modulate macrophage activation and polarization into M2 type tumor-associated macrophages, which promote tumor growth, progression, and metastasis. The mechanisms that mediate this polarization are not clear. Macrophages are phagocytic cells that participate in the clearance

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service