Skip to Content
Merck
All Photos(2)

Key Documents

SAB2105568

Sigma-Aldrich

Anti-SRD5A2, (N-terminal) antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-MGC138457

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
€498.00

€498.00


Estimated to ship on16 April 2025



Select a Size

Change View
100 μL
€498.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

€498.00


Estimated to ship on16 April 2025


biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

28 kDa

species reactivity

bovine, horse, dog, human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SRD5A2(6716)

General description

Steroid 5α-reductase type 2 (SRD5A2) enzyme is expressed in the male reproductory system and contains an N-terminal testosterone-binding domain and a C-terminal nicotinamide adenine dinucleotide phosphate (NADPH)-binding domain. The SRD5A2 gene is mapped on the human chromosome at 2p23.1.

Immunogen

Synthetic peptide directed towards the N terminal region of human SRD5A2

Biochem/physiol Actions

Steroid 5α-reductase type 2 (SRD5A2) enzyme mediates the conversion of testosterone to dihydrotestosterone (DHT). Mutations in the SRD5A2 gene are associated with an autosomal recessive form of 46, XY differences disorders of sexual development (DSD) in males characterized by underdeveloped and atypical genitalia. Overexpression of the SRD5A2 gene is associated with androgenic alopecia, benign prostatic hyperplasia (BPH), and prostate cancer. This gene is expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result in male pseudo-hermaphroditism, specifically pseudovaginal perineoscrotal hypospadias (PPSH).

Sequence

Synthetic peptide located within the following region: KHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQPLSLFGPPGTVLL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Shimin Yuan et al.
Steroids, 125, 61-66 (2017-07-01)
Hypospadias, a common congenital malformation of male external genitalia, is characterized mainly by an aberrant opening of the urethra on the ventral side of the penis. Depending on the severity of the disease, it can be classified into three types:
C Cocchetti et al.
Journal of endocrinological investigation, 43(8), 1131-1136 (2020-02-10)
Gender assignment represents one of the most controversial aspects of the clinical management of individuals with Differences of Sex Development, including 5α-Reductase-2 deficiency (SRD5A2). Given the predominant female appearance of external genitalia in individuals with SRD5A2 deficiency, most of them
Qingpin Xiao et al.
Nature communications, 11(1), 5430-5430 (2020-10-29)
Human steroid 5α-reductase 2 (SRD5A2) is an integral membrane enzyme in steroid metabolism and catalyzes the reduction of testosterone to dihydrotestosterone. Mutations in the SRD5A2 gene have been linked to 5α-reductase deficiency and prostate cancer. Finasteride and dutasteride, as SRD5A2

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service