SAB1403198

Monoclonal Anti-SULT1C2 antibody produced in mouse

clone 4D9, purified immunoglobulin, buffered aqueous solution

• Synonym(s): MGC149521, MGC34422, SULT1C, SULT1C2
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 4D9, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~37.33 kDa
• species reactivity: human
• technique(s): capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2bκ
• NCBI accession no.: BC058861
• UniProt accession no.: O75897
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SULT1C4(27233)

Description

General description

Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that belongs to the SULT1 subfamily, responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds. (provided by RefSeq)

Immunogen

SULT1C2 (AAH58861.1, 1 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MALHDMEDFTFDGTKRLSVNYVKGILQPTDTCDIWDKIWNFQAKPDDLLISTYPKAGTTWTQEIVELIQNEGDVEKSKRAPTHQRFPFLEMKIPSLGSGEYK

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable