Skip to Content
Merck
All Photos(7)

Key Documents

HPA008874

Sigma-Aldrich

Anti-FDFT1 antibody produced in rabbit

affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-FPP:FPP farnesyltransferase antibody produced in rabbit, Anti-Farnesyl-diphosphate farnesyltransferase antibody produced in rabbit, Anti-SQS antibody produced in rabbit, Anti-SS antibody produced in rabbit, Anti-Squalene synthetase antibody produced in rabbit

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
€541.00

€541.00


Estimated to ship on14 April 2025



Select a Size

Change View
100 μL
€541.00

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

€541.00


Estimated to ship on14 April 2025


biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

PEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICR

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... FDFT1(2222)

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
HPA006360HPA003097HPA000834
conjugate

unconjugated

conjugate

unconjugated

conjugate

unconjugated

conjugate

unconjugated

biological source

rabbit

biological source

rabbit

biological source

rabbit

biological source

rabbit

Quality Level

100

Quality Level

100

Quality Level

100

Quality Level

100

species reactivity

human

species reactivity

human

species reactivity

mouse, rat, human

species reactivity

human

form

buffered aqueous glycerol solution

form

buffered aqueous glycerol solution

form

buffered aqueous glycerol solution

form

buffered aqueous glycerol solution

General description

FDFT1 (farnesyl-diphosphate farnesyltransferase 1) is also known as squalene synthase (SS), and is an essential enzyme of the cholesterol biogenesis pathway. This protein has a putative molecular weight of 48,041 and is composed of 417 amino acids. Two variants of FDFT1 mRNA are found in humans, which differ at their 3′ untranslated regions. They are of 2kb and 1.55kb and are equally expressed in heart, lung, liver, kidney, pancreas and placenta. However, the 2kb transcript is abundant in heart and skeletal muscle.

Immunogen

Squalene synthetase recombinant protein epitope signature tag (PrEST)

Application

Anti-FDFT1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

FDFT1 (farnesyl-diphosphate farnesyltransferase 1) enzyme catalyzes the first committed reaction in steroid/hopanoid pathways. It catalyzes the conversion of two farnesyl diphosphates (FPPs) into squalene. It is also thought to be involved in carotenoid biosynthesis, where it might be responsible for the production of carotenoid dehydrosqualene. It determines the fate towards sterol synthesis. In prostate cancer cells, its expression is elevated by androgens, which are mevalonate/isoprenoid pathway intermediates which facilitate cholesterol synthesis. Thus, this enzyme might be implicated in cholesterol synthesis in cancer cells, and might be a therapeutic target for antineoplastic strategies. In chronic hepatitis C (CHC) patients, this protein is linked with advanced fibrosis in non-steatotic subgroup. Overexpression of FDFT1 results in elevated activation of tumor necrosis factor (TNF)-α receptor 1 and nuclear factor (NF)-κB pathways and increased expression of MMP (matrix metallopeptidase) 1, which in turn facilitates the metastasis of lung cancer.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86797

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Maiko Furubayashi et al.
FEBS letters, 588(3), 436-442 (2013-12-18)
The first committed steps of steroid/hopanoid pathways involve squalene synthase (SQS). Here, we report the Escherichia coli production of diaponeurosporene and diapolycopene, yellow C30 carotenoid pigments, by expressing human SQS and Staphylococcus aureus dehydrosqualene (C30 carotenoid) desaturase (CrtN). We suggest
Albert F Stättermayer et al.
Liver international : official journal of the International Association for the Study of the Liver, 34(3), 388-395 (2013-07-23)
In chronic hepatitis C (CHC), steatosis is associated with fibrosis and impaired response to antiviral therapy. Recently, a polymorphism of single nucleotide polymorphism SNP rs2645424 of farnesyl diphosphate farnesyl transferase 1 (FDFT1) was identified in NAFLD/NASH as a possible causal
Koen Brusselmans et al.
The Journal of biological chemistry, 282(26), 18777-18785 (2007-05-08)
Several cues for cell proliferation, migration, and survival are transmitted through lipid rafts, membrane microdomains enriched in sphingolipids and cholesterol. Cells obtain cholesterol from the circulation but can also synthesize cholesterol de novo through the mevalonate/isoprenoid pathway. This pathway, however
G Guan et al.
The Journal of biological chemistry, 270(37), 21958-21965 (1995-09-15)
We have cloned and characterized the 5'-flanking region of the gene encoding human squalene synthase. We report here the promoter activity of successively 5'-truncated sections of a 1 kilobase of this region by fusing it to the coding region of
Yi-Fang Yang et al.
American journal of respiratory and critical care medicine, 190(6), 675-687 (2014-08-26)
Metabolic alterations contribute to cancer development and progression. However, the molecular mechanisms relating metabolism to cancer metastasis remain largely unknown. To identify a key metabolic enzyme that is aberrantly overexpressed in invasive lung cancer cells and to investigate its functional

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service