Skip to Content
Merck
All Photos(1)

Key Documents

AV50815

Sigma-Aldrich

Anti-VGLL2 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-VGL2, Anti-VITO1, Anti-Vestigial like 2 (Drosophila)

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
€423.00

€423.00


Estimated to ship on13 May 2025



Select a Size

Change View
100 μL
€423.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

€423.00


Estimated to ship on13 May 2025


biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

33 kDa

species reactivity

horse, rat, rabbit, dog, human, bovine, guinea pig

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... VGLL2(245806)

Related Categories

Immunogen

Synthetic peptide directed towards the middle region of human VGLL2

Application

Anti-VGLL2 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.

Biochem/physiol Actions

Vestigial-like family member 2 (VGLL2) acts as a co-factor of transcriptional enhancer factor 1 (TEF-1) and regulates transcription during skeletal muscle development.[1] Members of VGLL family are involved in embryonic patterning, determination of cell fate, neural crest cell survival and craniofacial development in zebrafish.[1][2]

Sequence

Synthetic peptide located within the following region: RPPEAEYINSRCVLFTYFQGDISSVVDEHFSRALSQPSSYSPSCTSSKAP

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Christopher W Johnson et al.
Developmental biology, 357(1), 269-281 (2011-07-12)
Invertebrate and vertebrate vestigial (vg) and vestigial-like (VGLL) genes are involved in embryonic patterning and cell fate determination. These genes encode cofactors that interact with members of the Scalloped/TEAD family of transcription factors and modulate their activity. We have previously
Corinne Faucheux et al.
The International journal of developmental biology, 54(8-9), 1375-1382 (2010-08-17)
The Drosophila Vestigial and Scalloped proteins form heterodimers that control wing development and are involved in muscle differentiation. Four vestigial like genes have been described in mammals. Similar to the Drosophila vestigial gene, they encode a short conserved domain (TONDU)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service