Synthetic peptide directed towards the N terminal region of human TRIP13
Biochem/physiol Actions
TRIP13 protein is a hormone-dependent transcription factor. It interacts with the ligand-binding domain of thyroid hormone receptors.
Sequence
Synthetic peptide located within the following region: KDSQPIDLSACTVALHIFQLNEDGPSSENLEEETENIIAANHWVLPAAEF
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
The thyroid hormone (T3) receptors (TRs) are hormone-dependent transcription factors that regulate expression of a variety of specific target genes. To help elucidate the mechanisms that underlie this transcriptional regulation and other potential TR activities, we used the yeast interaction
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.