219483

Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, Negative Control

A scrambled caveolin-1 scaffolding domain peptide (C1-SD82-101) fused at the N-terminus to the Antennapedia internalization sequence (43-58).

• Synonym(s): Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, Negative Control, AP-Cav-X, Pen-C1-SD-X, RQIKIWFQNRRMKWKK- WGI DKASFTTFTVTKYWF RY, AP-Cav-X, Pen-C1-SD-X, RQIKIWFQNRRMKWKK-WGIDKASFTTFTVTKYWFRY
• Empirical Formula (Hill Notation): C₂₂₈H₃₃₅N₆₁O₄₉S
• Molecular Weight: 4746.54
• UNSPSC Code: 12352200

Properties

• Quality Level: 100
• Assay: ≥95% (HPLC)
• form: lyophilized solid
• manufacturer/tradename: Calbiochem^®
• storage condition: OK to freeze; desiccated (hygroscopic); protect from light
• color: white
• solubility: DMSO: 2 mg/mL
• shipped in: wet ice
• storage temp.: −20°C

Description

General description

A scrambled caveolin-1 scaffolding domain peptide (C1-SD_82-101) fused at the N-terminus to the Antennapedia internalization sequence (43-58). Serves as an useful negative control for studies using Caveolin-1 Scaffolding Domain Peptide, Cell-permeable (Cat. No. 219482).

A scrambled caveolin-1 scaffolding domain peptide (C1-SD_82-101) fused at the N-terminus to the Antennapedia internalization sequence (43-58). Serves as an useful negative control for studies using Caveolin-1 Scaffolding Domain Peptide, Cell-permeable (Cat. No. 219482).

Biochem/physiol Actions

Cell permeable: no

Primary Target
Negative control for studies using Caveolin-1 Scaffolding Domain Peptide, Cell-permeable (Cat. No. 219482).

Product does not compete with ATP.

Reversible: no

Packaging

Packaged under inert gas

Warning

Toxicity: Standard Handling (A)

Sequence

H-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Trp-Gly-Ile-Asp-Lys-Ala-Ser-Phe-Thr-Thr-Phe-Thr-Val-Thr-Lys-Tyr-Trp-Phe-Arg-Tyr-OH

Physical form

Supplied as a trifluoroacetate salt.

Reconstitution

Following reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.

Other Notes

Gratton, J.P., et al. 2003. Cancer Cell4, 31.
Sukumaran, S.K., et al. 2002. J. Biol. Chem.277, 50716.
Bucci, M., et al. 2000. Nat. Med.6, 1362.

Legal Information

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany