WH0000346M1

Monoclonal Anti-APOC4 antibody produced in mouse

clone 3D10, purified immunoglobulin, buffered aqueous solution

• Synonym(e): Anti-apolipoprotein C-IV
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 3D10, monoclonal
• Form: buffered aqueous solution
• Speziesreaktivität: human
• Methode(n): immunoprecipitation (IP): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG2aκ
• GenBank-Hinterlegungsnummer: BC020723
• UniProt-Hinterlegungsnummer: P55056
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... APOC4(346)

Beschreibung

Allgemeine Beschreibung

Apolipoprotein (apo)C4 gene is a member of the apolipoprotein gene family. It is expressed in the liver and has a predicted protein structure characteristic of the other genes in this family. Apo C4 is a 3.3-kb gene consisting of 3 exons and 2 introns; it is located 0.5 kb 5′ to the APOC2 gene. (provided by RefSeq)

Immunogen

APOC4 (AAH20723.1, 27 a.a. ~ 127 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
CQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG

Leistungsmerkmale und Vorteile

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Rechtliche Hinweise

GenBank is a registered trademark of United States Department of Health and Human Services

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)