SAB5702666

Anti-MCM4 Antibody, clone 5N0X3, Rabbit Monoclonal

• Synonym(e): CDC21, CDC54, NKCD, NKGCD, P1-CDC21, hCdc21
• UNSPSC-Code: 12352203
• NACRES: NA.46

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Materialien: colorless
• Klon: 5N0X3, monoclonal
• Form: liquid
• Mol-Gew.: 97 kDa
• Speziesreaktivität: human, rat, rat
• Konzentration: 0.88 mg/mL
• Methode(n): western blot: 1:500 - 1:2000
• Farbe: colorless
• Isotyp: IgG
• Immunogene Sequenz: LHREALKQSATDPRTGIVDISILTTGMSATSRKRKEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMFEEALRALADDDFLTVTGKTVRLL
• UniProt-Hinterlegungsnummer: P33991
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... MCM4(4173)

Beschreibung

Allgemeine Beschreibung

The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 6 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of this protein by CDC2 kinase reduces the DNA helicase activity and chromatin binding of the MCM complex. This gene is mapped to a region on the chromosome 8 head-to-head next to the PRKDC/DNA-PK, a DNA-activated protein kinase involved in the repair of DNA double-strand breaks. Alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq, Jul 2008]

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 764-863 of human MCM4 (P33991).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Anwendung

WB

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1