SAB2109044

Anti-SLC7A11 antibody produced in rabbit

affinity isolated antibody

• Synonym(e): CCBR1, xCT
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 55 kDa
• Speziesreaktivität (Voraussage durch Homologie): canine, rabbit, guinea pig, horse, bovine, rat, human, mouse
• Konzentration: 0.5 mg/mL
• Methode(n): western blot: 1 μg/mL
• NCBI-Hinterlegungsnummer: NM_014331
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... SLC7A11(57396)

Beschreibung

Allgemeine Beschreibung

SLC7A11 is a member of a heteromeric Na(+)-independent anionic amino acid transport system highly specific for cystine and glutamate. In this system, designated system Xc(-), the anionic form of cystine is transported in exchange for glutamate.

Immunogen

Synthetic peptide directed towards the middle region of human SLC7A11

Sequenz

Synthetic peptide located within the following region: KGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEK

Physikalische Form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: nwg
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable