SAB2108920

Anti-O3FAR1 (C-terminal) antibody produced in rabbit FITC conjugated

affinity isolated antibody

• Synonym(e): CRISTIN1, PWTSR, THSD2
• UNSPSC-Code: 12352203
• NACRES: NA.43

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: FITC conjugate
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 41 kDa
• Speziesreaktivität (Voraussage durch Homologie): canine, human, guinea pig, rat, mouse, rabbit, horse, bovine
• Konzentration: 0.5 mg/mL
• NCBI-Hinterlegungsnummer: NM_025079
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... FFAR4(338557)

Beschreibung

Allgemeine Beschreibung

GPR120 is a member of the rhodopsin family of G protein-coupled receptors (GPRs).

Sequenz

Synthetic peptide located within the following region: VVTHSEITKASRKRLTVSLAYSESHQIRVSQQDFRLFRTLFLLMVSFFIM

Physikalische Form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 12 - Non Combustible Liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable