SAB2108916

Anti-MS4A3 (N-terminal) antibody produced in rabbit FITC conjugated

affinity isolated antibody

• Synonym(e): FIME, KIAA1171, MGC102885
• UNSPSC-Code: 12352203
• NACRES: NA.45

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: FITC conjugate
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 24 kDa
• Speziesreaktivität (Voraussage durch Homologie): human
• Konzentration: 0.5 mg/mL
• NCBI-Hinterlegungsnummer: NM_006138
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... MS4A3(932)

Beschreibung

Allgemeine Beschreibung

This gene encodes a member of the membrane-spanning 4A gene family. Members of this protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This family member likely plays a role in signal transduction and may function as a subunit associated with receptor complexes. The gene encoding this protein is localized to 11q12, among a cluster of related family members. Alternative splicing may result in multiple transcript variants; however, not all variants have been fully described.

Sequenz

Synthetic peptide located within the following region: AGPEELNTSVYQPIDGSPDYQKAKLQVLGAIQILNAAMILALGVFLGSLQ

Physikalische Form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 12 - Non Combustible Liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable