SAB2107984

Anti-MTHFSD antibody produced in rabbit

IgG fraction of antiserum

• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: IgG fraction of antiserum
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 41kDa
• Speziesreaktivität: human, bovine, horse, dog, mouse
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): immunoblotting: suitable; immunohistochemistry: suitable
• NCBI-Hinterlegungsnummer: NM_022764
• UniProt-Hinterlegungsnummer: Q2M296
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... MTHFSD(64779)

Beschreibung

Allgemeine Beschreibung

The previously assigned protein identifier Q9H954 has been merged into Q2M296. Full details can be found on the UniProt database.

Immunogen

Synthetic peptide directed towards the N terminal region of human MTHFSD

Sequenz

Synthetic peptide located within the following region: EVKVDPDKPLEGVRLLVLQSKKTLLVPTPRLRTGLFNKITPPPGATKDIL

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 12 - Non Combustible Liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable