SAB2102232

Anti-SMAD4 antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-DPC4, Anti-JIP, Anti-MADH4, Anti-SMAD family member 4
• MDL-Nummer: MFCD01634190
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Antikörperform: affinity isolated antibody
• Qualitätsniveau: 100
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 60 kDa
• Speziesreaktivität: horse, bovine, sheep, guinea pig, dog, mouse, human, rat, rabbit, goat
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): immunohistochemistry: suitable; western blot: suitable
• UniProt-Hinterlegungsnummer: Q13485
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... SMAD4(4089)

Beschreibung

Immunogen

Synthetic peptide directed towards the N terminal region of human SMAD4

Biochem./physiol. Wirkung

SMAD4 is one of the Smad family members, which are essential intracellular signalling components of the transforming growth factor-beta (TGF-beta) superfamily. Smad2 and Smad3 are structurally highly similar and mediate TGF-beta signals. Smad4 is distantl

Sequenz

Synthetic peptide located within the following region: MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEK

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable