SAB2101578

Anti-NFATC3 antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-NFAT4, Anti-NFATX, Anti-Nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 115 kDa
• Speziesreaktivität: dog, mouse, human, horse, bovine
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): immunohistochemistry: suitable; western blot: suitable
• UniProt-Hinterlegungsnummer: Q12968
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... NFATC3(4775)

Beschreibung

Allgemeine Beschreibung

The nuclear factor of activated T cells 3 (NFATc3)/nuclear factor of activated T cells 4 (NFAT4) belongs to the NFAT family. It is expressed at high levels in the thymus. NFATc3 has a rel similarity domain (RSD) and the SP repeat region, characterized by the repeated motif SPxxSPxxSPrxsxx(D/E)(D/E)swl. The NFATc3 gene is located on human chromosome 16.

Immunogen

Synthetic peptide directed towards the N terminal region of human NFATC3

Anwendung

Anti-NFATC3 antibody produced in rabbit has been used in western blot analysis (1:1000).

Biochem./physiol. Wirkung

The nuclear factor of activated T cells 3 (NFATc3)/nuclear factor of activated T cells 4 (NFAT4) exhibits either pro-tumor or anti-tumor effects. It can block the proliferation and migration abilities of hepatoma cells. NFATc3 aids in reducing hepatitis B virus (HBV) replication. It can activate transcription. NFAT4 is necessary to drive the expression of the human polyomavirus JC virus (JCV) gene in glial cells.

Sequenz

Synthetic peptide located within the following region: AVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSDDQGSLSPARETSI

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable