SAB1409954

Monoclonal Anti-PCAF antibody produced in mouse

clone 4C10, purified immunoglobulin, buffered aqueous solution

• Synonym(e): CAF, P, P/CAF, PCAF
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 4C10, monoclonal
• Form: buffered aqueous solution
• Mol-Gew.: antigen 36.96 kDa
• Speziesreaktivität: human
• Methode(n): indirect ELISA: suitable
• Isotyp: IgG2aκ
• NCBI-Hinterlegungsnummer: NM_003884
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... PCAF(8850)

Beschreibung

Allgemeine Beschreibung

CBP and p300 are large nuclear proteins that bind to many sequence-specific factors involved in cell growth and/or differentiation, including c-jun and the adenoviral oncoprotein E1A. The protein encoded by this gene associates with p300/CBP. It has in vitro and in vivo binding activity with CBP and p300, and competes with E1A for binding sites in p300/CBP. It has histone acetyl transferase activity with core histones and nucleosome core particles, indicating that this protein plays a direct role in transcriptional regulation. (provided by RefSeq)

Immunogen

PCAF (NP_003875, 731 a.a. ~ 832 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable