SAB1409259

Monoclonal Anti-JAG2 antibody produced in mouse

clone 2D10, purified immunoglobulin, buffered aqueous solution

• Synonym(e): HJ2, SER2
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 2D10, monoclonal
• Form: buffered aqueous solution
• Mol-Gew.: antigen 36.41 kDa
• Speziesreaktivität: human
• Methode(n): indirect ELISA: suitable
• Isotyp: IgG2aκ
• NCBI-Hinterlegungsnummer: NM_002226
• UniProt-Hinterlegungsnummer: Q9Y219
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... JAG2(3714)

Beschreibung

Allgemeine Beschreibung

The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch gene family encode transmembrane receptors that are critical for various cell fate decisions. The protein encoded by this gene is one of several ligands that activate Notch and related receptors. Two transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Immunogen

JAG2 (NP_002217, 869 a.a. ~ 966 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GRSCWSRGTPFPHGSSWVEDCNSCRCLDGRRDCSKVWCGWKPCLLAGQPEALSAQCPLGQRCLEKAPGQCLRPPCEAWGECGAEEPPSTPCLPRSGHL

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable