SAB1408723

Monoclonal Anti-SGK2 antibody produced in mouse

clone 2F6, purified immunoglobulin, buffered aqueous solution

• Synonym(e): H-SGK2, dJ138B7.2
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 2F6, monoclonal
• Form: buffered aqueous solution
• Mol-Gew.: antigen 36.74 kDa
• Speziesreaktivität: human
• Methode(n): immunofluorescence: suitable; immunoprecipitation (IP): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG2aκ
• NCBI-Hinterlegungsnummer: NM_016276
• UniProt-Hinterlegungsnummer: Q9HBY8
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... SGK2(10110)

Beschreibung

Allgemeine Beschreibung

This gene encodes a serine/threonine protein kinase. Although this gene product is similar to serum- and glucocorticoid-induced protein kinase (SGK), this gene is not induced by serum or glucocorticoids. This gene is induced in response to signals that activate phosphatidylinositol 3-kinase, which is also true for SGK. Two alternate transcripts encoding two different isoforms have been described. (provided by RefSeq)

Immunogen

SGK2 (NP_057360, 244 a.a. ~ 344 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GVEPEDTTSTFCGTPEYLAPEVLRKEPYDRAVDWWCLGAVLYEMLHGLPPFYSQDVSQMYENILHQPLQIPGGRTVAACDLLQSLLHKDQRQRLGSKADFL

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable