SAB1403215

Monoclonal Anti-NENF antibody produced in mouse

clone 7D10, purified immunoglobulin, buffered aqueous solution

• Synonym(e): CIR2, NEUDESIN, SCIRP10, SPUF
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 7D10, monoclonal
• Form: buffered aqueous solution
• Mol-Gew.: antigen ~45.9 kDa
• Speziesreaktivität: human
• Methode(n): capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG2aκ
• NCBI-Hinterlegungsnummer: NM_013349
• UniProt-Hinterlegungsnummer: Q9UMX5
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Angaben zum Gen: human ... NENF(29937)

Beschreibung

Allgemeine Beschreibung

This gene encodes a neurotrophic factor that may play a role in neuron differentiation and development. A pseudogene of this gene is found on chromosome 12. Alternate splicing of this gene results in multiple transcript variants. (provided by RefSeq)

Immunogen

NENF (NP_037481.1, 1 a.a. ~ 172 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MVGPAPRRRLRPLAALALVLALAPGLPTARAGQTPRPAERGPPVRLFTEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDPADLTHDTTGLTAKELEALDEVFTKVYKAKYPIVGYTARRILNEDGSPNLDFKPEDQPHFDIKDEF

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 13 - Non Combustible Solids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable