SAB1402178

Monoclonal Anti-EGR2 antibody produced in mouse

clone 1G5, purified immunoglobulin, buffered aqueous solution

• Synonym(e): AT591, CMT1D, CMT4E, DKFZp686J1957, FLJ14547, KROX20
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 1G5, monoclonal
• Form: buffered aqueous solution
• Mol-Gew.: antigen ~34.58 kDa
• Speziesreaktivität: rat, human
• Methode(n): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG2bκ
• NCBI-Hinterlegungsnummer: NM_000399
• UniProt-Hinterlegungsnummer: P11161
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Angaben zum Gen: human ... EGR2(1959)

Beschreibung

Allgemeine Beschreibung

The protein encoded by this gene is a transcription factor with three tandem C2H2-type zinc fingers. Defects in this gene are associated with Charcot-Marie-Tooth disease type 1D (CMT1D), Charcot-Marie-Tooth disease type 4E (CMT4E), and with Dejerine-Sottas syndrome (DSS). Multiple transcript variants encoding two different isoforms have been found for this gene. (provided by RefSeq)

Immunogen

EGR2 (NP_000390.2, 217 a.a. ~ 293 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PGLFPMIPDYPGFFPSQCQRDLHGTAGPDRKPFPCPLDTLRVPPPLTPLSTIRNFTLGGPSAGVTGPGASGGSEGPR

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 13 - Non Combustible Solids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable