Direkt zum Inhalt
Merck

HPA048938

Sigma-Aldrich

Anti-SLC9A7 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(e):

Anti-NHE7, Anti-solute carrier family 9, subfamily A (NHE7, cation proton antiporter 7), member 7

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise


About This Item

UNSPSC-Code:
12352203
Human Protein Atlas-Nummer:
NACRES:
NA.41

Biologische Quelle

rabbit

Konjugat

unconjugated

Antikörperform

affinity isolated antibody

Antikörper-Produkttyp

primary antibodies

Klon

polyclonal

Produktlinie

Prestige Antibodies® Powered by Atlas Antibodies

Form

buffered aqueous glycerol solution

Speziesreaktivität

human

Methode(n)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50

Immunogene Sequenz

QVYDNQEPLREEDSDFILTEGDLTLTYGDSTVTANGSSSSHTASTSLEGSRRT

UniProt-Hinterlegungsnummer

Versandbedingung

wet ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... SLC9A7(84679)

Allgemeine Beschreibung

Solute carrier family 9 member 7 (SLC9A7), also called sodium/hydrogen exchanger 7 (NHE7), is a 80 kDa protein present in trans-Golgi complex. It is a sodium/hydrogen exchanger with N-terminal membrane spanning region and C-terminal hydrophilic tail. SLC9A7 is mapped to human chromosome Xp11.3.

Immunogen

solute carrier family 9, subfamily A (NHE7, cation proton antiporter 7), member 7 recombinant protein epitope signature tag (PrEST)

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem./physiol. Wirkung

Solute carrier family 9 member 7 (SLC9A7) maintains cation homeostasis in trans-Golgi. Its interaction with secretory carrier membrane protein (SCAMP) is crucial for regulating transport in the trans-Golgi complex. SLC9A7 functions like vacuolar (H+)-ATPases (V-ATPases), as a proton-loading transporter. SLC9A7 is highly is expressed in breast cancer and contributes to tumor progression. Polymorphisms in the SLC9A7 gene may contribute to pathogenesis of Alzheimer′s disease. Missense mutation in SLC9A7 is also implicated with metabolic disorder,cystinuria. Deletion of SLC9A7 gene is implicated X-linked disorder, resulting in mental retardation.

Leistungsmerkmale und Vorteile

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST84427

Physikalische Form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 1

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable


Analysenzertifikate (COA)

Suchen Sie nach Analysenzertifikate (COA), indem Sie die Lot-/Chargennummer des Produkts eingeben. Lot- und Chargennummern sind auf dem Produktetikett hinter den Wörtern ‘Lot’ oder ‘Batch’ (Lot oder Charge) zu finden.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

ZNF674: a new kruppel-associated box-containing zinc-finger gene involved in nonsyndromic X-linked mental retardation
Lugtenberg D, et al.
American Journal of Human Genetics, 78(2), 265-278 (2006)
The intracellular Na+/H+ exchanger NHE7 effects a Na+-coupled, but not K+-coupled proton-loading mechanism in endocytosis
Milosavljevic N, et al.
Cell Reports, 7(3), 689-696 (2014)
Delineation of cystinuria in Saudi Arabia: A case series
Obaid A, et al.
BMC Nephrology, 18(1), 50-50 (2017)
Secretory carrier membrane proteins interact and regulate trafficking of the organellar (Na+, K+)/H+ exchanger NHE7
Lin PJC, et al.
Journal of Cell Science, 118(9), 1885-1897 (2005)
A large scale multivariate parallel ICA method reveals novel imaging-genetic relationships for Alzheimer's disease in the ADNI cohort
Meda SA, et al.
Neuroimage, 60(3), 1608-1621 (2012)

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.