HPA018132

Anti-ZNHIT6 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-Serologically defined breast cancer antigen NY-BR-75, Anti-Zinc finger HIT domain-containing protein 6
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA018132
• NACRES: NA.43

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Erweiterte Validierung: recombinant expression; Learn more about Antibody Enhanced Validation
• Methode(n): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• Immunogene Sequenz: KEELMHGECVKEEKDFLKKEIVDDTKVKEEPPINHPVGCKRKLAMSRCETCGTEEAKYRCPRCMRYSCSLPCVKKHKAELTCNGVRDKTAYISIQQFTEMNLL
• UniProt-Hinterlegungsnummer: Q9NWK9
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... ZNHIT6(54680)

Beschreibung

Allgemeine Beschreibung

The gene has been mapped to human chromosome 1p22.3. Zinc finger HIT domain-containing protein-6 (ZNHIT6) encodes for a zinc finger protein, zinc finger HIT domain-containing protein-6.

Immunogen

Zinc finger HIT domain-containing protein 6 recombinant protein epitope signature tag (PrEST)

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem./physiol. Wirkung

Zinc finger HIT domain-containing protein-6 (ZNHIT6) is an assembly factor which participates in the complex required for small nucleolar RNA (snoRNA) accumulation, processing and nucleolar localization. The protein associates with U3 and U8 pre-snoRNA. RNAi-mediated depletion of ZNHIT6 results in a significant reduction of U3, U8 and U14 snoRNA levels in HeLa cells. Pull down assay showed ZNHIT6 interaction with nucleolar protein 58 (NOP58), nuclear FMRP-interacting protein 1 (NUFIP), transcription initiation factor TFIID subunit-9 (TAF9), TATA box-binding protein-interacting protein (TIP48, TIP49 - interaction regulated by binding and hydrolysis of ATP) and fibrillarin. Additionally, co-immunoprecipitation and yeast two hybrid revealed ZNHIT6 interaction with zinc finger HIT domain-containing protein-3 (ZNHIT3). Double homeobox protein-4 (DUX4), a transcription factor, which is a leading candidate of facioscapulohumeral dystrophy (FSHD) induces the expression of ZNHIT6.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST73695

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable