HPA015480

Anti-SERPINB2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-Monocyte Arg-serpin, Anti-PAI-2, Anti-Placental plasminogen activator inhibitor, Anti-Plasminogen activator inhibitor 2 precursor, Anti-Urokinase inhibitor
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA015480
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Methode(n): immunohistochemistry: 1:500- 1:1000
• Immunogene Sequenz: TQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNIGYIEDLKAQILELPYAGDVSMFLLLPDEIADVSTGLELLESEITYDKLNKWTSKD
• UniProt-Hinterlegungsnummer: P05120
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... SERPINB2(5055)

Beschreibung

Allgemeine Beschreibung

SERPINB2 (serpin peptidase inhibitor B2) is a member of a large family of proteins called serine protease inhibitors (serpins), the members of which are structurally related. It has a constitutive expression in only certain cell types such as, trophoblasts, neurons, pre-adipocytes, macrophages and keratinocytes. When localized intracellularly, it has a molecular weight of 47kDa, and is non-glycosylated. The secreted form is 60kDa, and is glycosylated. It has a C-D loop, which are α-helices acting as bridges between domains.

Immunogen

Plasminogen activator inhibitor 2 precursor recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-SERPINB2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Biochem./physiol. Wirkung

SERPINB2 (serpin peptidase inhibitor B2) functions as a suppressor of urokinase type plasminogen activator. It is involved in the survival of macrophages, differentiation of keratinocytes and monocytes, signaling pathways, apoptosis and cellular protection. It also has an immunomodulatory role, and aberrant expression of this protein is linked to asthma, pre-eclampsia, periodontal disease, and cancer. Its expression is induced by the carcinogen PMA (phorbol 12-myristate 13-acetate) in multiple cell types such as, monocytic lineage cells. In endothelial cells, it binds to proteasome complex, and thus, affects its activity. As proteasome activity determines the apoptotic fate of cells, elevated expression of this protein in endothelial cells might favor apoptosis. The expression of this protein is elevated in cervical cancer, and this is linked to high-risk human papillomavirus (HPV) and cervical lesion grade.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST71128

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)