HPA013547

Anti-CYP2C8 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-CYPIIC8, Anti-Cytochrome P450 2C8, Anti-P450 IIC2, Anti-P450 MP- 12/MP-20, Anti-P450 form 1, Anti-S-mephenytoin 4-hydroxylase
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA013547
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Erweiterte Validierung: orthogonal RNAseq; independent; Learn more about Antibody Enhanced Validation
• Methode(n): immunohistochemistry: 1:20-1:50; western blot: 0.04-0.4 μg/mL
• Immunogene Sequenz: KRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQICFIPV
• UniProt-Hinterlegungsnummer: P10632
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... CYP2C8(1558)

Beschreibung

Allgemeine Beschreibung

CYP2C8 (cytochrome P450, family 2, subfamily C, polypeptide 8) has been found to be expressed in the kidney, adrenal gland, brain, uterus, mammary gland, ovary, and duodenum. The gene is mapped to human chromosome 10q23.

Immunogen

Cytochrome P450 2C8 recombinant protein epitope signature tag (PrEST)

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem./physiol. Wirkung

CYP2C8 (cytochrome P450, family 2, subfamily C, polypeptide 8) gene encodes a protein belonging to the cytochrome P450 superfamily of enzymes that function as monooxygenases. It is the major enzyme in the liver and kidney that is involved in the metabolism of arachidonic acid to biologically active epoxyeicosatrienoic acids (EETs). EETs function in several processes such as, peptide hormone secretion in the pancreas and pituitary, Na⁺ transport and water reabsorption in the kidney, platelet aggregation, etc. It is also the primary enzyme functioning in the metabolism of anticancer drug paclitaxel. It can also metabolize precarcinogen benzo(α)pyrene in humans and may have a role in carcinogenesis. It is found to act on other drugs such as, roziglitazone, a drug used in patients with adult onset of diabetes. It also mediates the maintenance of vascular tone in coronary arteries.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST72891

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)