HPA005908

Anti-UCHL5 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-UCH-L5, Anti-Ubiquitin C-terminal hydrolase UCH37, Anti-Ubiquitin carboxyl-terminal hydrolase isozyme L5, Anti-Ubiquitin thioesterase L5
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA005908
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Methode(n): immunohistochemistry: 1:200- 1:500
• Immunogene Sequenz: CTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKT
• UniProt-Hinterlegungsnummer: Q9Y5K5
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... UCHL5(51377)

Beschreibung

Allgemeine Beschreibung

Ubiquitin C-terminal hydrolase L5 (UCHL5), a cysteine protease, is an integral part of the protein homeostasis network. It belongs to the family of ubiquitin C-terminal hydrolases (UCHs). UCHL5 is a proteasome-associated deubiquitinating enzyme, that is ubiquitously expressed in most of the normal human tissues. UCHL5 gene is located on human chromosome 1q31.2.

Immunogen

Ubiquitin carboxyl-terminal hydrolase isozyme L5 recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-UCHL5 antibody produced in rabbit has been used in immunohistochemistry(1:800).

Biochem./physiol. Wirkung

Ubiquitin C-terminal hydrolase L5 (UCHL5) is considered a new prognostic marker in rectal cancer and pancreatic ductal adenocarcinoma. UCHL5 along with Rpn13 plays a key role in maintaining the progression of cell-cycle and DNA replication. It is necessary for effective polyubiquitin removal from proteasomal substrates, which leads to proteasomal substrate breakdown. The absence of UCHL5 may also inhibit the degradation of specific substrates, resulting in apoptosis.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST70227

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable