HPA000287

Anti-GPKOW antibody produced in rabbit

Ab1, Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-G patch domain and KOW motifs-containing protein antibody produced in rabbit, Anti-G patch domain-containing protein 5 antibody produced in rabbit, Anti-Protein MOS2 homolog antibody produced in rabbit, Anti-Protein T54 antibody produced in rabbit
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA000287
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: mouse, rat, human
• Erweiterte Validierung: independent; Learn more about Antibody Enhanced Validation
• Methode(n): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:20-1:50
• Immunogene Sequenz: ELQSVKPQEAPKELVIPLIQNGHRRQPPARPPGPSTDTGALADGVVSQAVKELIAESKKSLEERENAGVDPTLAIPMIQKGCTPSGEGADSEPRAETVPEEANYEA
• UniProt-Hinterlegungsnummer: Q92917
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... GPKOW(27238)

Beschreibung

Allgemeine Beschreibung

G-patch (glycine-rich) domain and KOW (Kyrpides, Ouzounis and Woese) domain (GPKOW) is a RNA-binding protein that binds to RNA via pathway modulated by PKA (protein kinase A). It is present in human spliceosome. GPKOW is also known as T54 protein or modifier of snc 2 (MOS2) homolog, and it functions as an interaction partner for Cβ2 (C subunit of PKA). The gene is found to be located on human chromosome Xp11. GPKOW protein consists of one G-patch domain and two KOW motifs.

Immunogen

G patch domain and KOW motifs-containing protein recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-GPKOW antibody has been used in Western blotting. All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem./physiol. Wirkung

G-patch (glycine-rich) domain and KOW (Kyrpides, Ouzounis and Woese) domain (GPKOW) plays a crucial role in both alternative splicing and miRNA processing. This RNA binding protein acts as a cofactor for DHX16 (DEAH (Asp-Glu-Ala-His) box polypeptide 16 protein) activity in the spliceosome. The encoded protein also helps in suppressing the splicing defect caused by mutation of DHX16 gene.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST74012

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)