AV50215

Anti-ELFN2 antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-Extracellular leucine-rich repeat and fibronectin type III domain containing 2, Anti-KIAA1904, Anti-LRRC62, Anti-dJ63G5.3
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 90 kDa
• Speziesreaktivität: rat, guinea pig, human, horse, rabbit, mouse
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• NCBI-Hinterlegungsnummer: NP_443138
• UniProt-Hinterlegungsnummer: Q5R3F8
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... ELFN2(114794)

Beschreibung

Allgemeine Beschreibung

ELFN2 is characterized by leucine-rich repeat and reportedly has a role in innate immune system.

Immunogen

Synthetic peptide directed towards the N terminal region of human ELFN2

Anwendung

Anti-ELFN2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem./physiol. Wirkung

ELFN2 is a single-pass membrane protein. It contains 1 fibronectin type-III domain and 5 LRR (leucine-rich) repeats. The exact function of ELFN2 remains unknown.

Sequenz

Synthetic peptide located within the following region: PVSHPTPYSTDAQREPDENSGFNPDEILSVEPPASSTTDASAGPAIKLHH

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable