AV34420

Anti-HEXIM1 antibody produced in rabbit

IgG fraction of antiserum

• Synonym(e): Anti-Hexamethylene bis-acetamide inducible 1
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: IgG fraction of antiserum
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 41 kDa
• Speziesreaktivität: horse, pig, bovine, dog, rat, mouse, human
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• NCBI-Hinterlegungsnummer: NP_006451
• UniProt-Hinterlegungsnummer: O94992
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... HEXIM1(10614)

Beschreibung

Allgemeine Beschreibung

HEXIM1 is induced by hexamethylene bis-acetamide. It co-ordinates with 7SK snRNAand subsequently inhibits P-TEFb (CDK9/Cyclin T) and RNA polymerase II.
Rabbit Anti-HEXIM1 antibody recognizes bovine, human, mouse, rat, zebrafish, and canine HEXIM1.

Immunogen

Synthetic peptide directed towards the C terminal region of human HEXIM1

Anwendung

Rabbit Anti-HEXIM1 antibody can be used for western blot applications at a concentration of 0.6 μg/ml.

Biochem./physiol. Wirkung

HEXIM1 expression is induced by hexamethylene-bis-acetamide in vascular smooth muscle cells. The function of this protein is not yet known.

Sequenz

Synthetic peptide located within the following region: LESKRLGGDDARVRELELELDRLRAENLQLLTENELHRQQERAPLSKFGD

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable