MAB2290

Anti-Integrin α3 Antibody, cytoplasmic domain, clone 29A3

clone 29A3, Chemicon^®, from mouse

• Synonym(e): CD49c
• UNSPSC-Code: 12352203
• eCl@ss: 32160702
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Qualitätsniveau: 100
• Antikörperform: purified antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: 29A3, monoclonal
• Speziesreaktivität: human
• Hersteller/Markenname: Chemicon^®
• Methode(n): immunocytochemistry: suitable; immunohistochemistry: suitable; western blot: suitable
• Isotyp: IgG1
• NCBI-Hinterlegungsnummer: NM_002204.1; NM_005501.1
• UniProt-Hinterlegungsnummer: P26006
• Versandbedingung: wet ice
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... ITGA3(3675)

Beschreibung

Allgemeine Beschreibung

MAB2290 is a mouse monoclonal generated to a synthetic peptide in the cytoplasmic domain of integrin alpha 3A.

Spezifität

Anti-integrin alpha 3A (MAB2290) recognizes specifically the cytoplasmic domain of integrin subunit alpha 3A which is present in the basal layer in skin, glomeruli, Bowman′s capsules and distal tubuli in kidney, all vascular and capillary endothlia in brain, heart, and skin, and vascular smooth muscle cells in heart.

SPECIES REACTIVITIES:

Although untested, a braod range of species reactivity is expected due to the conserved nature of the epitope.

Immunogen

Synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha 3A including an additional N-terminal cysteine: CRTRALYEAKRQKAEMKSQPSETERLTDDY

Anwendung

Anti-Integrin α3 Antibody, cytoplasmic domain, clone 29A3 is an antibody against Integrin α3 for use in WB, IC, IH.

Western Blot

Immunocytochemistry

Immunohistochemistry (Frozen Sections)

Optimal working dilutions must be determined by the end user.

Physikalische Form

Format: Purified

Purified. Liquid in PBS containing 0.01% sodium azide.

Sonstige Hinweise

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

Rechtliche Hinweise

CHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany

Sicherheitshinweise

• Lagerklassenschlüssel: 12 - Non Combustible Liquids
• WGK: WGK 2
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable