Skip to Content
Merck
All Photos(2)

Documents

WH0002515M1

Sigma-Aldrich

Monoclonal Anti-ADAM2 antibody produced in mouse

clone 4A2, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-FTNB, Anti-PH30, Anti-PH30b, Anti-a disintegrin and metalloproteinase domain 2 (fertilin beta)

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

4A2, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ADAM2(2515)

General description

This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions. (provided by RefSeq)

Immunogen

ADAM2 (NP_001455, 376 a.a. ~ 475 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RLDPFFKQQAVCGNAKLEAGEECDCGTEQDCALIGETCCDIATCRFKAGSNCAEGPCCENCLFMSKERMCRPSFEECDLPEYCNGSSASCPENHYVQTGH

Biochem/physiol Actions

ADAM2 (disintegrin and metalloproteinase domain-containing protein 2) is an integrin binding protein. Absence of ADAM2 in mice causes defects in sperm-egg binding. In addition, it helps in transfer of sperm from the uterus into the oviduct.

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Ulyana V Desiderio et al.
PloS one, 5(10), e13744-e13744 (2010-11-10)
Integrins are heterodimeric cell adhesion molecules, with 18 α (ITGA) and eight β (ITGB) subunits forming 24 heterodimers classified into five families. Certain integrins, especially the α(4)/α(9) (ITGA4/ITGA9) family, interact with members of the ADAM (a disintegrin and metalloprotease) family.
Charles Gyamera-Acheampong et al.
Fertility and sterility, 93(4), 1112-1123 (2009-04-04)
To study the molecular basis for the accelerated capacitation rate in PCSK4-null sperm. Comparative and controlled experimental research study. Academic medical institute. Male mice C57BL/6J wild-type or null congenics for the Pcsk4 allele. Cauda and epididymal sperm were capacitated for

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service