SAB5702186

Anti-ACVR1 Antibody, clone 1J7G4, Rabbit Monoclonal

• Synonym(s): ACVR1, ACTRI, ACVR1A, ACVRLK2, ALK2, FOP, SKR1, TSRI, activin receptor type-1
• UNSPSC Code: 12352203
• NACRES: NA.46

Properties

• biological source: rabbit
• Quality Level: 100
• material: colorless
• clone: 1J7G4, monoclonal
• form: liquid
• mol wt: 57 kDa
• species reactivity: human, rat, rat
• concentration: 1.2 mg/mL
• technique(s): western blot: 1:500 - 1:1000
• color: colorless
• isotype: IgG
• immunogen sequence: VLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC
• UniProt accession no.: Q04771
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ACVR1(90)

Description

General description

Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I ( I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. This gene encodes activin A type I receptor which signals a particular transcriptional response in concert with activin type II receptors. Mutations in this gene are associated with fibrodysplasia ossificans progressive.

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 410-509 of human ACVR1 (Q04771).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1