Transmembrane protein 35 (TMEM35) is mostly expressed in hypothalamic-pituitary-adrenal (HPA) circuitry and limbic areas, including the hippocampus and amygdala of mice. TMEM35 sis also known as the unknown factor-1(TUF-1). Human TMEM35 consists of 167 amino acids and is located at human chromosome Xq22.
Immunogen
Synthetic peptide directed towards the C terminal region of human TMEM35
Biochem/physiol Actions
Transmembrane protein 35 (TMEM35) is a multi-pass membrane protein. Any alteration in Transmembrane protein 35 (TMEM35) causes long term memory loss as well as impairs behavioral functions. TMEM35 regulates cell cycle progression and thereby modulates osteosarcoma cell growth, migration and invasion, making it a potent drug development target for therapeutics. In zona glomerulosa, the neurite outgrowth after sodium depletion is regulated by TMEM35.
Sequence
Synthetic peptide located within the following region: VFGILLTCRLLIARKPEDRSSEKKPLPGNAEEQPSLYEKAPQGKVKVS
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Sodium depletion increases sympathetic neurite outgrowth and expression of a novel TMEM35 gene-derived protein (TUF1) in the rat adrenal zona glomerulosa
Tran, Phu, et al.
Endocrinology, 151(10), 4852-4860 (2010)
Downregulation of coding transmembrane protein 35 gene inhibits cell proliferation, migration and cell cycle arrest in osteosarcoma cells
Huang, Yi, et al.
Experimental and Therapeutic Medicine, 12(2), 581-588 (2016)
Deletion of novel protein TMEM35 alters stress-related functions and impairs long-term memory in mice
Kennedy, , et al.
American Journal of Physiology. Regulatory, Integrative and Comparative Physiology, 311(1), R166-R178 (2016)
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.