Skip to Content
Merck
All Photos(3)

Key Documents

SAB1400646

Sigma-Aldrich

Anti-SH3GLB2 antibody produced in mouse

IgG fraction of antiserum, buffered aqueous solution

Synonym(s):

Anti-KIAA1848

Sign Into View Organizational & Contract Pricing

Select a Size

50 μG
CZK 9,600.00

CZK 9,600.00


Please contact Customer Service for Availability


Select a Size

Change View
50 μG
CZK 9,600.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

CZK 9,600.00


Please contact Customer Service for Availability

biological source

mouse

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunofluorescence: suitable
western blot: 1 μg/mL

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SH3GLB2(56904)

General description

The gene SH3GLB2 (SH3 domain-containing GRB2-like protein B2) is mapped to human chromosome 9q34. The encoded protein belongs to the endophilin family of BAR and Src homology 3 domain-containing proteins. SH3GLB2 localizes in the meshwork of perinuclear filamentous structures. The protein contains an N-BAR (bin, amphiphysin and rvs) domain and a SH3 (src homology 3) domain.

Immunogen

SH3GLB2 (NP_064530.1, 1 a.a. ~ 395 a.a) full-length human protein.

Sequence
MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTEKILRQTEVLLQPNPSARVEEFLYEKLDRKVPSRVTNGELLAQYMADAASELGPTTPYGKTLIKVAEAEKQLGAAERDFIHTASISFLTPLRNFLEGDWKTISKERRLLQNRRLDLDACKARLKKAKAAEAKATTVPDFQETRPRNYILSASASALWNDEVDKAEQELRVAQTEFDRQAEVTRLLLEGISSTHVNHLRCLHEFVKSQTTYYAQCYRHMLDLQKQLGRFPGTFVGTTEPASPPLSSTSPTTAVATMPVVPSVASLAPPGEASLCLEEVAPPASGTRKARVLYDYEAADSSELALLADELITVYSLPGMDPDWLIGERGNKKGKVPVTYLELLS

Biochem/physiol Actions

SH3GLB2 (SH3 domain-containing GRB2-like protein B2) associates with SH3GLB1. It also interacts with plectin-1 and vimentin. SH3GLB2 is involved in reorganization of vimentin around nuclei and nuclear positioning.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Oculo-Auriculo-Vertebral Spectrum: A Review of the Literature
Beleza-Meireles A, et al.
Journal of Genetic Syndromes & Gene Therapy, 5 (2014)
Roland Lehmann et al.
Mucosal immunology, 11(3), 627-642 (2018-01-04)
Protein secretion upon TLR, TNFR1, and IFNGR ligation in the human airways is considered to be central for the orchestration of pulmonary inflammatory and immune responses. In this study, we compared the gene expression and protein secretion profiles in response
Christian Vannier et al.
The Journal of biological chemistry, 288(38), 27619-27637 (2013-08-08)
Proteins of the Bin/amphiphysin/Rvs (BAR) domain superfamily are essential in controlling the shape and dynamics of intracellular membranes. Here, we present evidence for the unconventional function of a member of the endophilin family of BAR and Src homology 3 domain-containing
B Pierrat et al.
Genomics, 71(2), 222-234 (2001-02-13)
A new cDNA encoding a protein of 362 amino acids designated SH3GLB1, for SH3 domain GRB2-like endophilin B1, was identified in a yeast two-hybrid screen devoted to the identification of new partners interacting with the apoptosis inducer Bax. SH3GLB1 shows

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service