MSST0062

SILu^™Lite APOD, Apolipoprotein D human

recombinant, expressed in HEK 293 cells, MS Protein Standard, ≥95% (SDS-PAGE)

• Synonym(s): Apo-D, ApoD
• NACRES: NA.24
• UNSPSC Code: 23201100
• Form: lyophilized powder
• Assay: ≥95% (SDS-PAGE)
• Recombinant: expressed in HEK 293 cells

Properties

• recombinant: expressed in HEK 293 cells
• Quality Segment: 200
• assay: ≥95% (SDS-PAGE)
• form: lyophilized powder
• technique(s): protein mass spectrometry: suitable
• UniProt accession no.: P05090
• shipped in: ambient
• storage temp.: −20°C
• Gene Information: human ... APOD(347)

Description

General description

SILu^™Lite APOD is a recombinant human protein expressed in human 293 cells. It consists of 189 amino acids (including a C-terminal polyhistidine tag), with a calculated molecular mass of 21.69 kDa. SILu^™Lite APOD is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Biochem/physiol Actions

Apolipoprotein D is a member of the Apolipoprotein family. Unlike other lipoproteins, which are mainly produced in the liver, apolipoprotein D is mainly produced in the brain and testes. It was found to be a putative biomarker of androgen receptor function in androgen insensitivity syndrome, the most common cause of disorders of sex development. Apolipoprotein D is associated with neurological disorders and nerve injury, especially related to myelin sheath. It was shown to be elevated in a rat model of stroke, and is elevated in patients with schizophrenia, bipolar disorder, and Alzheimer′s disease.

Physical form

Supplied as a lyophilized powder containing phosphate buffered saline.

Other Notes

QAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLSDYKDDDDKGHHHHHHHHGGQ

Legal Information

SILu is a trademark of Sigma-Aldrich Co. LLC

Safety Information

• Storage Class: 11 - Combustible Solids
• WGK: WGK 2
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable