Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
| Size/SKU | Availability | Price |
|---|---|---|
50 μg | Please contact Customer Service for Availability | CZK 17,900.00 |
About This Item
NACRES:
NA.24
UNSPSC Code:
23201100
Form:
lyophilized powder
Assay:
≥95% (SDS-PAGE)
Recombinant:
expressed in HEK 293 cells
General description
SILu™Lite APOD is a recombinant human protein expressed in human 293 cells. It consists of 189 amino acids (including a C-terminal polyhistidine tag), with a calculated molecular mass of 21.69 kDa. SILu™Lite APOD is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.
Biochem/physiol Actions
Apolipoprotein D is a member of the Apolipoprotein family. Unlike other lipoproteins, which are mainly produced in the liver, apolipoprotein D is mainly produced in the brain and testes. It was found to be a putative biomarker of androgen receptor function in androgen insensitivity syndrome, the most common cause of disorders of sex development. Apolipoprotein D is associated with neurological disorders and nerve injury, especially related to myelin sheath. It was shown to be elevated in a rat model of stroke, and is elevated in patients with schizophrenia, bipolar disorder, and Alzheimer′s disease.
Physical form
Supplied as a lyophilized powder containing phosphate buffered saline.
Other Notes
QAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLSDYKDDDDKGHHHHHHHHGGQ
Legal Information
SILu is a trademark of Sigma-Aldrich Co. LLC
1 of 1
This Item | |||
|---|---|---|---|
| recombinant expressed in HEK 293 cells | recombinant expressed in HEK 293 cells | recombinant expressed in HEK 293 cells | recombinant expressed in HEK 293 cells |
| assay ≥95% (SDS-PAGE) | assay ≥95% (SDS-PAGE) | assay ≥95% (SDS-PAGE) | assay ≥98% (SDS-PAGE) |
| form lyophilized powder | form lyophilized powder | form liquid | form lyophilized powder |
| shipped in ambient | shipped in ambient | shipped in dry ice | shipped in - |
| storage temp. −20°C | storage temp. −20°C | storage temp. −20°C | storage temp. −20°C |
| UniProt accession no. | UniProt accession no. | UniProt accession no. | UniProt accession no. |
Storage Class
11 - Combustible Solids
wgk
WGK 2
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
