HPA017432
Anti-MGAT1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonym(s):
Anti-Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase, Anti-GNT-I, Anti-GlcNAc-T I, Anti-N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase I
Sign Into View Organizational & Contract Pricing
All Photos(5)
About This Item
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50
immunogen sequence
AVIPILVIACDRSTVRRCLDKLLHYRPSAELFPIIVSQDCGHEETAQAIASYGSAVTHIRQPDLSSIAVPPDHRKFQGYYKIARHYRWALGQVFRQFRFPAAVVVEDDLEVAPDFFEYFRATYPLLKADPSLWCVSAWNDNGKEQMVD
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
glycosylation
Gene Information
human ... MGAT1(4245)
Related Categories
General description
Mannosyl-(α-1, 3)-glycoprotein-β-1, 2-N-acetylglucosaminyltransferase (MGAT1) gene is mapped to human chromosome 5q35. It codes for a 445 amino acid transmembrane protein with a luminal catalytic domain, localized to the medial compartment of the Golgi apparatus.
MGAT1 gene is a housekeeping gene. It is expressed as two RNA transcripts, smaller one of 2.7-3.0kb and larger of 3.1kb. Both are expressed in heart, lung, skeletal muscle and pancreas. However, only larger transcript is present in the brain.
MGAT1 gene is a housekeeping gene. It is expressed as two RNA transcripts, smaller one of 2.7-3.0kb and larger of 3.1kb. Both are expressed in heart, lung, skeletal muscle and pancreas. However, only larger transcript is present in the brain.
Immunogen
Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
MGAT1 (mannosyl-(α-1, 3)-glycoprotein-β-1, 2-N-acetylglucosaminyltransferase 1) catalyzes the first step in the conversion of oligomannose to N-glycans. Members of MGAT enzyme family play a vital role in dietary fat absorption. Cell surface proteins, N-glycosylated by MGAT1, assist in cell–cell interactions and binding of cytokines and various other factors to the outer plasma membrane. MGAT1 gene is found to be significantly associated with body weight among women .
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST71926
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Asa Johansson et al.
Obesity (Silver Spring, Md.), 18(4), 803-808 (2009-10-24)
As major risk-factors for diabetes and cardiovascular diseases, the genetic contribution to obesity-related traits has been of interest for decades. Recently, a limited number of common genetic variants, which have replicated in different populations, have been identified. One approach to
J A Jacobsson et al.
International journal of obesity (2005), 36(1), 119-129 (2011-02-10)
Recently a genome-wide association analysis from five European populations identified a polymorphism located downstream of the mannosyl-(α-1,3)-glycoprotein-β-1,2-N-acetylglucosaminyltransferase (MGAT1) gene that was associated with body-weight. In the present study, associations between MGAT1 variants combined with obesity and insulin measurements were investigated
B Yip et al.
The Biochemical journal, 321 ( Pt 2), 465-474 (1997-01-15)
UDP-GlcNAc: alpha-3-D-mannoside beta-1,2-N-acetylglucosaminyltransferase I (EC 2.4.1.101; GlcNAc-T I) is a medial-Golgi enzyme which catalyses the first step in the conversion of oligomannose-type to N-acetyl-lactosamine- and hybrid-type N-glycans and is essential for normal embryogenesis in the mouse. Previous work indicated the
R Kumar et al.
Proceedings of the National Academy of Sciences of the United States of America, 87(24), 9948-9952 (1990-12-01)
This laboratory has previously identified a human gene encoding N-acetylglucosaminyltransferase I (GlcNAc-TI; EC 2.4.1.101) by complementation of the glycosylation defect in the Lec1 Chinese hamster ovary (CHO) cell mutant. A phage lambda library prepared from genomic DNA of a tertiary
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service