Skip to Content
Merck
All Photos(7)

Key Documents

HPA014840

Sigma-Aldrich

Anti-YIF1A antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-54TMp, Anti-Protein YIF1A, Anti-YIP1-interacting factor homolog A

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
CZK 14,200.00

CZK 14,200.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
CZK 14,200.00

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

CZK 14,200.00


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human, mouse, rat

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

ALMYFIVRSLRTAALGPDSMGGPVPRQRLQ

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... YIF1A(10897)

General description

YIF1A (Yip1 interacting factor homolog A) belongs to the Yip1p/Yif1p family of proteins, which in humans, contains nine members. YIF1A is the human ortholog of Yif1p, which is a budding yeast protein. It resides in endoplasmic reticulum (ER), ER-Golgi intermediate compartment (ERGIC) and steady state cis-Golgi. This protein has four-five putative transmembrane regions, present at the C-terminal. The molecular weight of this protein is 35.5kDa, and it has a hydrophilic N-terminal, facing the cytoplasm.

Immunogen

Protein YIF1A recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

YIF1A (Yip1 interacting factor homolog A) is a Yip1p interacting protein, with which it forms a heteromeric complex. This complex is essential for the binding of endoplasmic reticulum (ER)-derived vesicles with Bos1p and Sec22p proteins of SNARE complex. It might be involved in maintaining the structure of Golgi apparatus. It is also an interacting partner of vesicle-associated membrane protein (VAMP) associated protein B (VAPB), which is an essential part of the early secretory pathway. Both these proteins play essential roles in ER-Golgi transport, and errors in YIF1A sorting might be a contributing factor to VAPB-associated motor neuron disease. It is also essential for the normal growth of dendrites. It has a ubiquitous expression in the central nervous system (CNS). Studies in mice show that this protein could be one of the factors implicated in amyotrophic lateral sclerosis (ALS).

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST73072

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Marijn Kuijpers et al.
The EMBO journal, 32(14), 2056-2072 (2013-06-06)
The vesicle-associated membrane protein (VAMP) associated protein B (VAPB) is an integral membrane protein localized to the endoplasmic reticulum (ER). The P56S mutation in VAPB has been linked to motor neuron degeneration in amyotrophic lateral sclerosis type 8 (ALS8) and
Changjiang Jin et al.
Biochemical and biophysical research communications, 334(1), 16-22 (2005-07-02)
Yip1p and Yif1p are essential for transport from ER to Golgi stack during the early secretory pathway in budding yeast. Here, we report the identification and characterization of human Yif1. Sequence analysis revealed that human Yif1 (HsYif1), like most of
H Matern et al.
The EMBO journal, 19(17), 4485-4492 (2000-09-06)
Through two-hybrid interactions, protein affinity and localization studies, we previously identified Yip1p, an integral yeast Golgi membrane protein able to bind the Ras-like GTPases Ypt1p and Ypt31p in their GDP-bound conformation. In a further two-hybrid screen, we identified Yif1p as
Yumi Yoshida et al.
Experimental cell research, 314(19), 3427-3443 (2008-08-23)
Yip1p/Yif1p family proteins are five-span transmembrane proteins localized in the Golgi apparatus and the ER. There are nine family members in humans, and YIPF5 and YIF1A are the human orthologs of budding yeast Yip1p and Yif1p, respectively. We raised antisera
Soo Jung Lee et al.
PloS one, 18(2), e0281094-e0281094 (2023-02-09)
The most common inherited cause of vascular dementia and stroke, cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL), is caused by mutations in NOTCH3. Post-translationally altered NOTCH3 accumulates in the vascular media of CADASIL arteries in areas of

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service