Skip to Content
Merck
All Photos(1)

Key Documents

AV48212

Sigma-Aldrich

Anti-PEBP1 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-HCNP, Anti-PBP, Anti-PEBP, Anti-Phosphatidylethanolamine binding protein 1, Anti-RKIP

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

21 kDa

species reactivity

mouse, bovine, rat, guinea pig, horse, human, rabbit

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PEBP1(5037)

General description

PEBP1 is a phosphatidylethanolamine binding protein that interacts with nucleotides and Raf-1 peptides. Studies in rat have revealed that PEBP1 is downregulated during hypoxia.
Rabbit Anti-PEBP1 antibody recognizes human, mouse, chicken, canine, bovine, and rabbit PEBP1.

Immunogen

Synthetic peptide directed towards the C terminal region of human PEBP1

Application

Rabbit Anti-PEBP1 antibody is suitable for western blot applications at a concentration of 1.25μg/ml.

Biochem/physiol Actions

PEBP1 binds ATP, opioids and phosphatidylethanolamine. It has lower affinity for phosphatidylinositol and phosphatidylcholine. It is also a serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase.

Sequence

Synthetic peptide located within the following region: LSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Sandeepta Burgula et al.
Journal of molecular neuroscience : MN, 41(1), 36-47 (2009-08-26)
In order to understand dementia and other ailments associated with high altitude hypoxia, adult Sprague Dawley male rats were exposed to simulated conditions of high altitude (7,500 m above sea level, 59 mmHg) for a period of 5 days and
Laurette Tavel et al.
PloS one, 7(4), e36187-e36187 (2012-05-05)
Human Phosphatidylethanolamine binding protein 1 (hPEBP1) also known as Raf kinase inhibitory protein (RKIP), affects various cellular processes, and is implicated in metastasis formation and Alzheimer's disease. Human PEBP1 has also been shown to inhibit the Raf/MEK/ERK pathway. Numerous reports

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service