Skip to Content
Merck
All Photos(1)

Documents

AV46887

Sigma-Aldrich

Anti-TSPAN12 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-NET-2, Anti-TM4SF12, Anti-Tetraspanin 12

Sign Into View Organizational & Contract Pricing
All Photos(1)

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

35 kDa

species reactivity

mouse, dog, guinea pig, rat, bovine, horse, human, rabbit

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

NP_036470

UniProt accession no.

O95859

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TSPAN12(23554)

Immunogen

Synthetic peptide directed towards the middle region of human TSPAN12

Application

Anti-LETM1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/mL.

Biochem/physiol Actions

TSPAN12 (tetraspanin 12) gene encodes a multi-pass membrane protein that belongs to tetraspanin family. TSPAN12 interacts with ADAM10 and stimulates its maturation and thereby facilitates ADAM10-dependent proteolysis of amyloid precursor protein (APP). In cancer cells, knockdown of TSPAN12 decreases membrane type-1 matrix metalloproteinase (MT1-MMP) proteolytic functions. Mutation in TSPAN12 gene results in autosomal-dominant familial exudative vitreoretinopathy.

Sequence

Synthetic peptide located within the following region: EFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGISIGVTQ

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Guohua Ji et al.
Molecules and cells, 42(7), 557-567 (2019-08-01)
TSPAN12, a member of the tetraspanin family, has been highly connected with the pathogenesis of cancer. Its biological function, however, especially in ovarian cancer (OC), has not been well elucidated. In this study, The Cancer Genome Atlas (TCGA) dataset analysis
James A Poulter et al.
American journal of human genetics, 86(2), 248-253 (2010-02-18)
Familial exudative vitreoretinopathy (FEVR) is an inherited blinding disorder of the retinal vascular system. Although mutations in three genes (LRP5, FZD4, and NDP) are known to cause FEVR, these account for only a fraction of FEVR cases. The proteins encoded
Daosong Xu et al.
FASEB journal : official publication of the Federation of American Societies for Experimental Biology, 23(11), 3674-3681 (2009-07-10)
Using mass spectrometry, we identified ADAM10 (a membrane-associated metalloproteinase) as a partner for TSPAN12, a tetraspanin protein. TSPAN12-ADAM10 interaction was confirmed by reciprocal coimmunoprecipitation in multiple tumor cell lines. TSPAN12, to a greater extent than other tetraspanins (CD81, CD151, CD9
Marc A Lafleur et al.
Molecular biology of the cell, 20(7), 2030-2040 (2009-02-13)
Membrane type-1 matrix metalloproteinase (MT1-MMP) supports tumor cell invasion through extracellular matrix barriers containing fibrin, collagen, fibronectin, and other proteins. Here, we show that simultaneous knockdown of two or three members of the tetraspanin family (CD9, CD81, and TSPAN12) markedly

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service