AV34677

Anti-KLHL14 antibody produced in rabbit

IgG fraction of antiserum

• Synonym(s): Anti-Kelch-like 14 (Drosophila)
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: 2

Properties

• biological source: rabbit
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 71 kDa
• species reactivity: guinea pig, bovine, human, dog, rat, rabbit, mouse
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_065856
• UniProt accession no.: Q9P2G3
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... KLHL14(57565)

Description

General description

KLHL14 is a protein member of the kelch-like family.
Rabbit anti-KLHL14 antibody recognizes chicken, canine, bovine, human, mouse, and rat KLHL14.

The previously assigned protein identifier Q8WU41 has been merged into Q9P2G3. Full details can be found on the UniProt database.

Immunogen

Synthetic peptide directed towards the N terminal region of human KLHL14

Application

Rabbit anti-KLHL14 antibody is suitable for western blot assays and for IHC assays at 4-8 μg/ml.

Biochem/physiol Actions

KLHL14 is a member of the KLHL family.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: MSRSGDRTSTFDPSHSDNLLHGLNLLWRKQLFCDVTLTAQGQQFHCHKAV

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable