AV32208

Anti-GSH2 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-GS homeobox 2, Anti-GSH2
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: IHC, WB
• Citations: 1

Properties

• biological source: rabbit
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 32 kDa
• species reactivity: rabbit, bovine, dog, horse, human, pig
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable, western blot: suitable
• NCBI accession no.: NP_573574
• UniProt accession no.: Q9BZM3
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... GSH2(170825)

Description

General description

GSH2 is a homeobox protein that regulates dorsoventral patterning in mammalian telencephalon.
Rabbit Anti-GSH2 antibody recognizes rat, human, mouse, and canine GSH2.

Immunogen

Synthetic peptide directed towards the N terminal region of human GSH2

Application

Rabbit Anti-GSH2 antibody can be used for western blot applications at a concentration of 1μg/ml.

Biochem/physiol Actions

homeobox protein GSH-2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: MSRSFYVDSLIIKDTSRPAPSLPEPHPGPDFFIPLGMPPPLVMSVSGPGC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable