613571
TIRAP Inhibitor Peptide, Control, Cell-Permeable
The TIRAP Inhibitor Peptide, Control, Cell-Permeable serves as a control for TIRAP Inhibitor Peptide. This small molecule/inhibitor is primarily used for Inflammation/Immunology applications.
Synonym(s):
TIRAP Inhibitor Peptide, Control, Cell-Permeable, Mal Peptide, MyD88-Adapter Like Peptide, Toll-interleukin 1 Receptor (TIR) domain-containing Adapter Protein Peptide, Ant-Tirap 151-138, TIRAP Peptide, Control, (RQIKIWFQNRRMKWKKSVIAGGPAADRLQL), Mal Peptide, MyD88-Adapter Like Peptide, Toll-interleukin 1 Receptor (TIR) domain-containing Adapter Protein Peptide, Ant-Tirap151-138, TIRAP Peptide, Control, (RQIKIWFQNRRMKWKKSVIAGGPAADRLQL)
Select a Size
| Size/SKU | Availability | Price |
|---|---|---|
1 mg | Estimated to ship on14 August 2026fromAreál Kühne+Nagel spol. s r.o. | 7 850,00 CZK |
About This Item
7 850,00 CZK
Estimated to ship on14 August 2026Details
Quality Segment
assay
≥97% (HPLC)
form
lyophilized solid
manufacturer/tradename
Calbiochem®
storage condition
OK to freeze, desiccated (hygroscopic), protect from light
color
white
solubility
DMSO: 5 mg/mL
shipped in
wet ice
storage temp.
−20°C
General description
Biochem/physiol Actions
Control for TIRAP inhibitor
Packaging
Physical form
Preparation Note
Other Notes
Legal Information
Disclaimer
1 of 1
This Item | |||
|---|---|---|---|
| description The TIRAP Inhibitor Peptide, Control, Cell-Permeable serves as a control for TIRAP Inhibitor Peptide. This small molecule/inhibitor is primarily used for Inflammation/Immunology applications. | description The TIRAP Inhibitor Peptide, Cell-Permeable blocks LPS-, but not CpG-induced NF-κB activation. This small molecule/inhibitor is primarily used for Inflammation/Immunology applications. | description A cell-permeable Antennapedia-NBD mutated fusion peptide analog of NEMO-Binding Domain Binding Peptide that serves as a negative control. | description The STAT3 Inhibitor Peptide, Cell-Permeable controls the biological activity of STAT3. |
| form lyophilized solid | form lyophilized solid | form lyophilized solid | form lyophilized solid |
| assay ≥97% (HPLC) | assay ≥97% (HPLC) | assay ≥95% (HPLC) | assay ≥95% (HPLC) |
| Quality Level 100 | Quality Level 100 | Quality Level 100 | Quality Level 100 |
| manufacturer/tradename Calbiochem® | manufacturer/tradename Calbiochem® | manufacturer/tradename Calbiochem® | manufacturer/tradename Calbiochem® |
| storage temp. −20°C | storage temp. −20°C | storage temp. −20°C | storage temp. −20°C |
| storage condition OK to freeze, protect from light, desiccated (hygroscopic) | storage condition OK to freeze, desiccated (hygroscopic), protect from light | storage condition OK to freeze, desiccated (hygroscopic) | storage condition OK to freeze, desiccated (hygroscopic) |
Storage Class
11 - Combustible Solids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.