374087

Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1)

liquid, clone HO-1-1, Calbiochem^®

• Synonym(s): Anti-HO-1, Anti-Hsp32
• NACRES: NA.41
• UNSPSC Code: 12352203
• Clone: HO-1-1, monoclonal
• Species reactivity: human, rat, canine, monkey, mouse, bovine
• Application: —
• Citations: 9

Properties

• biological source: mouse
• Quality Segment: 100
• antibody form: purified antibody
• antibody product type: primary antibodies
• clone: HO-1-1, monoclonal
• form: liquid
• contains: ≤0.1% sodium azide as preservative
• species reactivity: human, rat, canine, monkey, mouse, bovine
• manufacturer/tradename: Calbiochem^®
• storage condition: OK to freeze, avoid repeated freeze/thaw cycles
• dilution: (Immunoblotting (4 µg/mL, chemiluminescence); Immunocytochemistry (1:1000); Immunoprecipitation (20 µg/mL))
• isotype: IgG1
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: bovine ... Hmox1(513221) ; dog ... Hmox1(442987) ; human ... HMOX1(3162) ; mouse ... Hmox1(15368) ; rat ... Hmox1(24451) ; rhesus monkey ... Hmox1(719266)

Description

General description

Anti-Heme Oxygenase-1, mouse monoclonal, clone HO-1-1, recognizes the ~32 kDa HO-1 in a variety of species. It is validated for use in Western blotting, immunocytochemistry, and immunoprecipitation.

Protein G purified mouse monoclonal antibody. Recognizes the ~32 kDa heme oxygenase (HO-1) protein.

Recognizes the ~32 kDa HO-1 protein.

Immunogen

Human

a synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide

Application

Immunoblotting (4 µg/ml, chemiluminescence)

Immunocytochemistry (1:1000)

Immunoprecipitation (20 µg/ml)

Packaging

Please refer to vial label for lot-specific concentration.

Physical form

In PBS, 50% glycerol.

Preparation Note

Following initial thaw, aliquot and freeze (-20°C).

Other Notes

Does not cross-react with HO-2. Variables associated with assay conditions will dictate the proper working dilution.

Yoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
Maines, M.D. 1988. FASEB J.2, 2557.
Trakshel, G.M., et al. 1986 J. Biol. Chem.261, 11131.

Legal Information

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Toxicity: Standard Handling (A)

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk: WGK 1