SAB1404550

Monoclonal Anti-ZBTB16 antibody produced in mouse

clone 1F10, purified immunoglobulin, buffered aqueous solution

• Synonyma: PLZF, ZNF145
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: 1F10, monoclonal
• Application: ELISA (c), ELISA (i), WB
• Citations: -

Vlastnosti

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1F10, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~37.11 kDa
• species reactivity: human
• technique(s): capture ELISA: suitable, indirect ELISA: suitable, western blot: 1-5 μg/mL
• isotype: IgG2aκ
• NCBI accession no.: BC029812
• UniProt accession no.: Q05516
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ZBTB16(7704)

Popis

General description

This gene is a member of the Krueppel C2H2-type zinc-finger protein family and encodes a zinc finger transcription factor that contains nine Kruppel-type zinc finger domains at the carboxyl terminus. This protein is located in the nucleus, is involved in cell cycle progression, and interacts with a histone deacetylase. Specific instances of aberrant gene rearrangement at this locus have been associated with acute promyelocytic leukemia (APL). Alternate transcriptional splice variants have been characterized. (provided by RefSeq)

Immunogen

ZBTB16 (AAH29812, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QRELFSKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVEQHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHR

Physical form

Solution in phosphate buffered saline, pH 7.4

Bezpečnostní informace

• Skladovací třída: 10 - Combustible liquids
• Co se děje?: WGK 1
• Bod vzplanutí (°F): Not applicable
• Bod vzplanutí (°C): Not applicable