AV44054

Anti-SLC25A28 antibody produced in rabbit

affinity isolated antibody

• Synonyma: Anti-DKFZp547C109, Anti-MFRN2, Anti-MRS3/4, Anti-MRS4L, Anti-NPD016, Anti-Solute carrier family 25, member 28
• UNSPSC Code: 12352203
• NACRES: NA.41

Vlastnosti

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 39 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable; western blot: suitable
• NCBI accession no.: NP_112489
• UniProt accession no.: Q96A46
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SLC25A28(81894)

Popis

Immunogen

Synthetic peptide directed towards the C terminal region of human SLC25A28

Application

Anti-SLC25A28 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Biochem/physiol Actions

SLC25A28 also known as mitoferrin 2 (MFRN2) belongs to mitochondrial solute carrier family.It transports mitochondrial iron into the developing erythrocytes. High concentrations of iron are highly toxic; the regulation of iron transport in the vertebrate cells by MFRN1 and 2 is therefore critical.

Sequence

Synthetic peptide located within the following region: NTQESLALNSHITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPST

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Bezpečnostní informace

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable