HPA002279
Anti-PLVAP antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonym(s):
PLVAP Antibody - Anti-PLVAP antibody produced in rabbit, Plvap Antibody, Anti-Fenestrated endothelial-linked structure protein antibody produced in rabbit, Anti-PV-1 antibody produced in rabbit, Anti-Plasmalemma vesicle protein 1 antibody produced in rabbit, Anti-Plasmalemma vesicle-associated protein antibody produced in rabbit
Sign Into View Organizational & Contract Pricing
All Photos(4)
About This Item
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
enhanced validation
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunohistochemistry: 1:500-1:1000
immunogen sequence
KEQLQKVQALCLPLDKDKFEMDLRNLWRDSIIPRSLDNLGYNLYHPLGSELASIRRACDHMPSLMSSKVEELARSLRADIERVARENSDLQRQKLEAQQGLRASQEAKQKVEKEAQAREAKLQAECSR
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... PLVAP(83483)
General description
Plasmalemma vesicle associated protein (PLVAP) is a rod-like type II membrane amino-glycosylated glycoprotein with molecular mass of 60kDa. It consists of a short intracellular tail and a long extracellular domain. There are four glycosylation sites, a proline-rich region and two large coiled-coil domains. In culture and in situ state it exists as homodimers.
The PLVAP gene is mapped to human chromosome 19p13.11.
Immunogen
Plasmalemma vesicle-associated protein recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-PLVAP antibody produced in rabbit has been used in immunohistochemistry.
Biochem/physiol Actions
PLVAP (plasmalemma vesicle associated protein) is an endothelial-specific integral membrane glycoprotein involved in the biogenesis and regulation of stomatal diaphragms of caveolae, transendothelial channels (TECs), vesiculovacuolar organelles (VVOs) and diaphragms of endothelial fenestrae. It is an endothelium-specific protein. It forms the viatl radial fibrils, a key structural component, for the stomatal diaphragm (SD) and fenestral diaphragm (FD). Studies have suggested that PLVAP dimers form fibrils of the diaphragms with microvascular permeability.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST85160
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Targeted drug delivery via caveolae-associated protein PV1 improves lung fibrosis
Marchetti GM, et al.
Communications biology, 2(1), 92-92 (2019)
Replication of caucasian loci associated with osteoporosis-related traits in East Asians
Kim BJ, et al.
Journal of bone metabolism, 23(4), 233-242 (2016)
Medulloblastoma genotype dictates blood brain barrier phenotype
Phoenix TN, et al.
Cancer Cell, 29(4), 508-522 (2016)
Fan Yang et al.
Frontiers in oncology, 11, 683367-683367 (2021-07-06)
Glioblastoma (GBM) is the most aggressive and lethal type of brain tumors. Magnetic resonance imaging (MRI) has been commonly used for GBM diagnosis. Contrast enhancement (CE) on T1-weighted sequences are presented in nearly all GBM as a result of high
Radu V Stan et al.
Molecular biology of the cell, 15(8), 3615-3630 (2004-05-25)
PV1 is an endothelial-specific integral membrane glycoprotein associated with the stomatal diaphragms of caveolae, transendothelial channels, and vesiculo-vacuolar organelles and the diaphragms of endothelial fenestrae. Multiple PV1 homodimers are found within each stomatal and fenestral diaphragm. We investigated the function
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service