Skip to Content
Merck
All Photos(5)

Key Documents

HPA006427

Sigma-Aldrich

ANTI-PLIN3 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-47 kDa MPR-binding protein, Anti-47 kDa mannose 6-phosphate receptor-binding protein, Anti-Cargo selection protein TIP47, Anti-M6PRBP1, Anti-Mannose-6-phosphate receptor-binding protein 1, Anti-PP17, Anti-Placental protein 17

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

RNAi knockdown
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

SLGKLRATKQRAQEALLQLSQALSLMETVKQGVDQKLVEGQEKLHQMWLSWNQKQLQGPEKEPPKPEQVESRALTMFRDIAQQLQATCTSLGSSIQGLPTNVKDQVQQARRQVEDLQATFSSIHS

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... M6PRBP1(10226)

General description

PLIN3 (perilipin 3) is a lipid droplet-associated protein, which is highly expressed, especially in adipocytes. It is a member of the PAT (perilipin, adipophilin, and the tail-interacting protein) family of proteins, which includes five members. The N-terminal of this protein contains PAT-1 domain, and the C-terminal contains the PAT-2 domain. Both these domains are highly conserved regions. It has a molecular weight of 47kDa.

Immunogen

Mannose-6-phosphate receptor-binding protein 1 recombinant protein epitope signature tag (PrEST)

Application

ANTI-PLIN3 antibody produced in rabbit is used for Immuno-precipitation.
Anti-M6PRBP1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

PLIN3 (perilipin 3) and coatomer GTPases are responsinble for increased oxidation of fat in skeletal muscle tissues, post-exercise and lipolytic stimulation. Thus, in patients with polycystic ovary syndrome (PCOS), these together are involved in the control of lipolysis and triglyceride storage. In neutrophils derived from HL-60 cell line, PLIN3 is responsible for the synthesis of cytoplasmic lipid droplets (LDs). It is also involved in the biogenesis and secretion of prostaglandin E2 (PGE2). It promotes the replication of HIV-1 (human immunodeficiency virus) and vaccinia virus, but inhibits protein synthesis of Sendai virus, thus, acting as a viral restriction factor.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70468

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Alyssa S Zembroski et al.
Frontiers in oncology, 11, 576326-576326 (2021-06-19)
One of the characteristic features of metastatic breast cancer is increased cellular storage of neutral lipid in cytoplasmic lipid droplets (CLDs). CLD accumulation is associated with increased cancer aggressiveness, suggesting CLDs contribute to metastasis. However, how CLDs contribute to metastasis
Carole Bampi et al.
Virus research, 173(2), 354-363 (2013-01-26)
The cellular tail-interacting 47-kDa protein (TIP47) acts positively on HIV-1 and vaccinia virus production. We show here that TIP47, in contrast, acts as a restriction factor for Sendai virus production. This conclusion is supported by the occurrence of increased or
Abdellah Akil et al.
Nature communications, 7, 12203-12203 (2016-07-16)
The accumulation of lipid droplets (LD) is frequently observed in hepatitis C virus (HCV) infection and represents an important risk factor for the development of liver steatosis and cirrhosis. The mechanisms of LD biogenesis and growth remain open questions. Here
Jeffrey D Covington et al.
PloS one, 9(3), e91675-e91675 (2014-03-19)
Lipid droplet-associated proteins such as perilipin 3 (PLIN3) and coatomer GTPase proteins (GBF1, ARF1, Sec23a, and ARFRP1) are expressed in skeletal muscle but little is known so far as to their regulation of lipolysis. We aimed here to explore the
Fuyuki Nose et al.
PloS one, 8(8), e71542-e71542 (2013-08-13)
Cytosolic lipid droplets (LDs), which are now recognized as multifunctional organelles, accumulate in leukocytes under various inflammatory conditions. However, little is known about the characteristic features of LDs in neutrophils. In this study, we show that perilipin-3 (PLIN3; formerly called

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service