SAB1407995

Anti-DHDDS antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• Sinónimos: CIT, CPT, DS, FLJ13102, HDS
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: antigen ~34.3 kDa
• species reactivity: human
• technique(s): western blot: 1 μg/mL
• NCBI accession no.: BC004117.2
• UniProt accession no.: Q86SQ9
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... DHDDS(79947)

Descripción

General description

Dehydrodolichyl diphosphate (dedol-PP) synthase catalyzes cis-prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier lipid required for the biosynthesis of several classes of glycoproteins.[supplied by OMIM

Immunogen

DHDDS (AAH04117.1, 1 a.a. ~ 294 a.a) full-length human protein.

Sequence
MSWIKEGELSLWERFCANIIKAGPMPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKRSKSEVDGLMDLARQKFSRLMEEKCFLNVCFAYTSRHEISNAVREMAWGVEQGLLDPSDISESLLDKCLYTNRSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQPVLWPEYTFWNLFEAILQFQMNHSVLQKARDMYAEERKRQQLERDQATVTEQLLREGLQASGDAQLRRTRLHKLSARREERVQGFLQALELKRADWLARLGTASA

Biochem/physiol Actions

Dehydrodolichyl diphosphate synthase subunit (DHDDS) has a role in the final steps of dolichol-pyrophosphate pathway. It is involved in chaining of 17–21 isoprene units. Mutations in the gene encoding this protein have been associated with retinitis pigmentosa.

Physical form

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable