Saltar al contenido
Merck
Todas las fotos(1)

Key Documents

HPA051516

Sigma-Aldrich

Anti-MAN1B1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-MANA-ER, Anti-MRT15

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:50- 1:200

immunogen sequence

METGLSPEIVHFNLYPQPGRRDVEVKPADRHNLLRPETVESLFYLYRVTGDRKYQDWGWEILQSFSRFTRVPSGGYSSINNVQDPQKP

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... MAN1B1(11253)

General description

Mannosidase alpha class 1B member 1 (MAN1B1), also called endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase, is a 79.5 kDa type II membrane protein. It has a cytoplasmic tail, transmembrane domain, middle stem region and a large catalytic domain at the C-terminus.(1) MAN1B1 gene has 13 exons and is mapped to human chromosome 9q34.3.

Immunogen

mannosidase, alpha, class 1B, member 1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Mannosidase alpha class 1B member 1 (MAN1B1) catalyses the removal of mannose residues during N-glycan biosynthesis. It is part of endoplasmic reticulum associated degradation (ERAD) of glycoproteins. It is also part of the endoplasmic reticulum (ER) quality control machinery. Mutation in MAN1B1 is implicated in nonsyndromic autosomal-recessive intellectual disability disorder. Deficiency of MAN1B1 impacts N-glycosylation and is associated with congenital disorders of glycosylation (CDG). MAN1B1 is highly expressed in bladder cancer and silencing of its expression impacts the cancer progression, making MAN1B1 a potential drug target.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST85733

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

MAN1B1 mutation leads to a recognizable phenotype: a case report and future prospects
Hoffjan S, et al.
Molecular Syndromology, 6(2), 58-62 (2015)
Mutations in the alpha 1, 2-mannosidase gene, MAN1B1, cause autosomal-recessive intellectual disability
Rafiq MA, et al.
American Journal of Human Genetics, 89(1), 176-182 (2011)
MAN1B1 deficiency: an unexpected CDG-II
Rymen D, et al.
PLoS Genetics, 9(12), e1003989-e1003989 (2013)
Mammalian ER mannosidase I resides in quality control vesicles, where it encounters its glycoprotein substrates
Benyair R, et al.
Molecular Biology of the Cell, 26(2), 172-184 (2015)
MAN1B1 is associated with poor prognosis and modulates proliferation and apoptosis in bladder cancer
Wang HF, et al.
Gene, 679(12), 314-319 (2018)

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico