HPA036655

Anti-HTRA1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-ARMD7, Anti-HtrA, Anti-IGFBP5-protease, Anti-PRSS11
• UNSPSC Code: 12352203
• Human Protein Atlas Number: HPA036655
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• product line: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• species reactivity: human
• technique(s): immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:20-1:50
• immunogen sequence: GSDANTYANLCQLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIA
• UniProt accession no.: Q92743
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... HTRA1(5654)

Descripción

General description

The gene HTRA1 (HtrA serine peptidase 1) is mapped to human chromosome 10q26. The gene encodes a serine protease. It belongs to the HTRA family of proteins. The protein has an extracellular export signal, a IGFBP (insulin-like growth factor-binding protein) domain, a Kazal-like structure, a serine protease module and a C-terminal PDZ (PSD-95, Discs-large and ZO-1) binding motif.

Immunogen

HtrA serine peptidase 1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.
Anti-HTRA1 antibody produced in rabbit has been used in immunohistochemistry.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Biochem/physiol Actions

HTRA1 (HtrA serine peptidase 1) plays an important role in protein degradation and cell signaling. It is also involved in development of many organs and of various pathologies (neoplastic and degenerative diseases). HTRA1 exhibits tumor suppressor activities. Mutations in this gene are associated with two diseases, CARASIL (cerebral autosomal recessive arteriopathy with subcortical infarcts and leukoencephalopathy) and AMD (age-related macular degeneration).

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST79654

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable