HPA035832

Anti-CD33 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-FLJ00391, Anti-SIGLEC-3, Anti-SIGLEC3, Anti-p67
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA035832
• NACRES: NA.43

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• Formulario: buffered aqueous glycerol solution
• reactividad de especies: human
• validación mejorada: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• técnicas: immunohistochemistry: 1:200-1:500
• secuencia del inmunógeno: KTHRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNPSKDTSTEYSEVRTQ
• Nº de acceso UniProt: P20138
• aplicaciones: research pathology
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... CD33(945)

Descripción

Descripción general

Myeloid cell surface antigen CD33 (cluster of differentiation 33), also known as SIGLEC3 (sialic acid binding Ig-like lectins) and GP67, belongs to the CD33-related SIGLEC gene family. It is a type 1 transmembrane protein and has two immunoglobulin-like extracellular domains, a single transmembrane area and two intracellular inhibitory motifs. The CD33 gene is located on human chromosome 19q13.

Inmunógeno

CD33 molecule

Aplicación

Anti-CD33 antibody has been used in immunohistochemical staining.

Acciones bioquímicas o fisiológicas

CD33 (cluster of differentiation 33) is mainly involved in anti-inflammatory signaling, cell adhesion and endocytosis functions. CD33 serves as a myeloid differentiation marker. Mutations in the CD33 gene are associated with Alzheimer′s disease susceptibility and acute myeloid leukemia treatment efficacy.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST71736

Forma física

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable